SCOPe 2.05: Domain d2uydx_: 2uyd X:

Lineage for d2uydx_ (2uyd X:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily)
   beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432

4. Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (2 families)

5. Family d.35.1.1: Heme-binding protein A (HasA) [54622] (2 proteins)
   automatically mapped to Pfam PF06438

6. Protein automated matches [190253] (1 species)
   not a true protein

7. Species Serratia marcescens [TaxId:615] [187035] (2 PDB entries)

8. Domain d2uydx_: 2uyd X: [168228]
   automated match to d1b2va_
   complexed with act, hem, zn; mutant

Details for d2uydx_

PDB Entry: 2uyd, 2.7 Å

PDB Description: crystal structure of the smhasa mutant h83a

PDB Compounds: (X:) hemophore hasa

SCOPe Domain Sequences for d2uydx_:

Sequence; same for both SEQRES and ATOM records:

>d2uydx_ d.35.1.1 (X:) automated matches {Serratia marcescens [TaxId: 615]}
mafsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaisst
anqvtafvaggnltytlfnepaatlygqldslsfgdglsggdtspysiqvpdvsfgglnl
sslqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaatav

Timeline for d2uydx_:

• d2uydx_ first appeared in SCOPe 2.01
  
• d2uydx_ appears in SCOPe 2.04
  
• d2uydx_ appears in SCOPe 2.06
  
• d2uydx_ appears in the current release, SCOPe 2.08