Lineage for d2uydx_ (2uyd X:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1023651Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily)
    beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432
  4. 1023652Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (1 family) (S)
  5. 1023653Family d.35.1.1: Heme-binding protein A (HasA) [54622] (2 proteins)
  6. 1023665Protein automated matches [190253] (1 species)
    not a true protein
  7. 1023666Species Serratia marcescens [TaxId:615] [187035] (2 PDB entries)
  8. 1023669Domain d2uydx_: 2uyd X: [168228]
    automated match to d1b2va_
    complexed with act, hem, zn; mutant

Details for d2uydx_

PDB Entry: 2uyd (more details), 2.7 Å

PDB Description: crystal structure of the smhasa mutant h83a
PDB Compounds: (X:) hemophore hasa

SCOPe Domain Sequences for d2uydx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uydx_ d.35.1.1 (X:) automated matches {Serratia marcescens [TaxId: 615]}
mafsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaisst
anqvtafvaggnltytlfnepaatlygqldslsfgdglsggdtspysiqvpdvsfgglnl
sslqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaatav

SCOPe Domain Coordinates for d2uydx_:

Click to download the PDB-style file with coordinates for d2uydx_.
(The format of our PDB-style files is described here.)

Timeline for d2uydx_: