Lineage for d2uyca_ (2uyc A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378488Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1378489Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1379122Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (4 proteins)
    automatically mapped to Pfam PF00145
  6. 1379156Protein automated matches [190244] (3 species)
    not a true protein
  7. 1379161Species Haemophilus haemolyticus [TaxId:726] [187017] (6 PDB entries)
  8. 1379166Domain d2uyca_: 2uyc A: [168227]
    automated match to d10mha_
    protein/DNA complex; complexed with gol, sah, so4; mutant

Details for d2uyca_

PDB Entry: 2uyc (more details), 2 Å

PDB Description: hhai dna methyltransferase r163n mutant complex with 13mer gcgc-gmgc oligonucleotide and sah
PDB Compounds: (A:) modification methylase hhai

SCOPe Domain Sequences for d2uyca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uyca_ c.66.1.26 (A:) automated matches {Haemophilus haemolyticus [TaxId: 726]}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkneriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

SCOPe Domain Coordinates for d2uyca_:

Click to download the PDB-style file with coordinates for d2uyca_.
(The format of our PDB-style files is described here.)

Timeline for d2uyca_: