SCOPe 2.06: Domain d2uyba_: 2uyb A:

Lineage for d2uyba_ (2uyb A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)

6. Protein automated matches [190784] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [188035] (6 PDB entries)

8. Domain d2uyba_: 2uyb A: [168226]
   automated match to d1uw8a_
   complexed with fmt, mn, trs; mutant

Details for d2uyba_

PDB Entry: 2uyb, 2.1 Å

PDB Description: s161a mutant of bacillus subtilis oxalate decarboxylase oxdc

PDB Compounds: (A:) oxalate decarboxylase oxdc

SCOPe Domain Sequences for d2uyba_:

Sequence; same for both SEQRES and ATOM records:

>d2uyba_ b.82.1.2 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
dipqpirgdkgatvkiprnierdrqnpdmlvppetdhgtvsnmkfsfsdthnrlekggya
revtvrelpisenlasvnmrlkpgairelhwhkeaewaymiygsarvtivdekgrsfidd
vgegdlwyfpsglphsiqaleegaefllvfddgsfaenstfqltdwlahtpkeviaanfg
vtkeeisnlpgkekyifenqlpgslkddivegpngevpypftyrlleqepieseggkvyi
adstnfkvsktiasalvtvepgamrelhwhpnthewqyyisgkarmtvfasdghartfny
qagdvgyvpfamghyvenigdeplvfleifkddhyadvslnqwlamlpetfvqahldlgk
dftdvlskekhpvvkkk

Timeline for d2uyba_:

• d2uyba_ first appeared in SCOPe 2.01
  
• d2uyba_ appears in SCOPe 2.05
  
• d2uyba_ appears in SCOPe 2.07
  
• d2uyba_ appears in the current release, SCOPe 2.08