Lineage for d2uyaa_ (2uya A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2403752Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2403830Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 protein domains)
  6. 2403945Protein automated matches [190784] (2 species)
    not a true protein
  7. 2403946Species Bacillus subtilis [TaxId:1423] [188035] (6 PDB entries)
  8. 2403948Domain d2uyaa_: 2uya A: [168225]
    automated match to d1uw8a_
    complexed with cl, gol, mn, trs; mutant

Details for d2uyaa_

PDB Entry: 2uya (more details), 2 Å

PDB Description: del162-163 mutant of bacillus subtilis oxalate decarboxylase oxdc
PDB Compounds: (A:) oxalate decarboxylase oxdc

SCOPe Domain Sequences for d2uyaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uyaa_ b.82.1.2 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
dipqpirgdkgatvkiprnierdrqnpdmlvppetdhgtvsnmkfsfsdthnrlekggya
revtvrelpisenlasvnmrlkpgairelhwhkeaewaymiygsarvtivdekgrsfidd
vgegdlwyfpsglphsiqaleegaefllvfddgsfsstfqltdwlahtpkeviaanfgvt
keeisnlpgkekyifenqlpgslkddivegpngevpypftyrlleqepieseggkvyiad
stnfkvsktiasalvtvepgamrelhwhpnthewqyyisgkarmtvfasdghartfnyqa
gdvgyvpfamghyvenigdeplvfleifkddhyadvslnqwlamlpetfvqahldlgkdf
tdvlskekhpvvkkk

SCOPe Domain Coordinates for d2uyaa_:

Click to download the PDB-style file with coordinates for d2uyaa_.
(The format of our PDB-style files is described here.)

Timeline for d2uyaa_: