Lineage for d1bgc__ (1bgc -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46942Fold a.26: 4-helical cytokines [47265] (1 superfamily)
  4. 46943Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
  5. 46944Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)
  6. 46951Protein Granulocyte-colony stimulating factor (G-CSF) [47268] (3 species)
  7. 46952Species Cow (Bos taurus) [TaxId:9913] [47270] (1 PDB entry)
  8. 46953Domain d1bgc__: 1bgc - [16822]

Details for d1bgc__

PDB Entry: 1bgc (more details), 1.7 Å

PDB Description: crystal structure of canine and bovine granulocyte-colony stimulating factor (g-csf)

SCOP Domain Sequences for d1bgc__:

Sequence, based on SEQRES records: (download)

>d1bgc__ a.26.1.1 (-) Granulocyte-colony stimulating factor (G-CSF) {Cow (Bos taurus)}
slpqsfllkcleqvrkiqadgaelqerlcaahklchpeelmllrhslgipqaplsscssq
slqlrgclnqlhgglflyqgllqalagispelaptldtlqldvtdfatniwlqmedlgaa
pavqptqgamptftsafqrraggvlvasqlhrflelayrglryla

Sequence, based on observed residues (ATOM records): (download)

>d1bgc__ a.26.1.1 (-) Granulocyte-colony stimulating factor (G-CSF) {Cow (Bos taurus)}
slpqsfllkcleqvrkiqadgaelqerlcaahklchpeelmllrhslgipqaplsscssq
slqlrgclnqlhgglflyqgllqalagispelaptldtlqldvtdfatniwlqmedlgaa
pamptftsafqrraggvlvasqlhrflelayrglryla

SCOP Domain Coordinates for d1bgc__:

Click to download the PDB-style file with coordinates for d1bgc__.
(The format of our PDB-style files is described here.)

Timeline for d1bgc__: