![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
![]() | Protein Granulocyte-colony stimulating factor (G-CSF) [47268] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [47270] (1 PDB entry) |
![]() | Domain d1bgca_: 1bgc A: [16822] |
PDB Entry: 1bgc (more details), 1.7 Å
SCOPe Domain Sequences for d1bgca_:
Sequence, based on SEQRES records: (download)
>d1bgca_ a.26.1.1 (A:) Granulocyte-colony stimulating factor (G-CSF) {Cow (Bos taurus) [TaxId: 9913]} slpqsfllkcleqvrkiqadgaelqerlcaahklchpeelmllrhslgipqaplsscssq slqlrgclnqlhgglflyqgllqalagispelaptldtlqldvtdfatniwlqmedlgaa pavqptqgamptftsafqrraggvlvasqlhrflelayrglryla
>d1bgca_ a.26.1.1 (A:) Granulocyte-colony stimulating factor (G-CSF) {Cow (Bos taurus) [TaxId: 9913]} slpqsfllkcleqvrkiqadgaelqerlcaahklchpeelmllrhslgipqaplsscssq slqlrgclnqlhgglflyqgllqalagispelaptldtlqldvtdfatniwlqmedlgaa pamptftsafqrraggvlvasqlhrflelayrglryla
Timeline for d1bgca_: