Lineage for d1bgca_ (1bgc A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705449Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 2705456Protein Granulocyte-colony stimulating factor (G-CSF) [47268] (3 species)
  7. 2705457Species Cow (Bos taurus) [TaxId:9913] [47270] (1 PDB entry)
  8. 2705458Domain d1bgca_: 1bgc A: [16822]

Details for d1bgca_

PDB Entry: 1bgc (more details), 1.7 Å

PDB Description: crystal structure of canine and bovine granulocyte-colony stimulating factor (g-csf)
PDB Compounds: (A:) granulocyte colony-stimulating factor

SCOPe Domain Sequences for d1bgca_:

Sequence, based on SEQRES records: (download)

>d1bgca_ a.26.1.1 (A:) Granulocyte-colony stimulating factor (G-CSF) {Cow (Bos taurus) [TaxId: 9913]}
slpqsfllkcleqvrkiqadgaelqerlcaahklchpeelmllrhslgipqaplsscssq
slqlrgclnqlhgglflyqgllqalagispelaptldtlqldvtdfatniwlqmedlgaa
pavqptqgamptftsafqrraggvlvasqlhrflelayrglryla

Sequence, based on observed residues (ATOM records): (download)

>d1bgca_ a.26.1.1 (A:) Granulocyte-colony stimulating factor (G-CSF) {Cow (Bos taurus) [TaxId: 9913]}
slpqsfllkcleqvrkiqadgaelqerlcaahklchpeelmllrhslgipqaplsscssq
slqlrgclnqlhgglflyqgllqalagispelaptldtlqldvtdfatniwlqmedlgaa
pamptftsafqrraggvlvasqlhrflelayrglryla

SCOPe Domain Coordinates for d1bgca_:

Click to download the PDB-style file with coordinates for d1bgca_.
(The format of our PDB-style files is described here.)

Timeline for d1bgca_: