SCOPe 2.07: Domain d1bgca_: 1bgc A:

Lineage for d1bgca_ (1bgc A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 protein domains)

6. Protein Granulocyte-colony stimulating factor (G-CSF) [47268] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47270] (1 PDB entry)

8. Domain d1bgca_: 1bgc A: [16822]

Details for d1bgca_

PDB Entry: 1bgc, 1.7 Å

PDB Description: crystal structure of canine and bovine granulocyte-colony stimulating factor (g-csf)

PDB Compounds: (A:) granulocyte colony-stimulating factor

SCOPe Domain Sequences for d1bgca_:

Sequence, based on SEQRES records:

>d1bgca_ a.26.1.1 (A:) Granulocyte-colony stimulating factor (G-CSF) {Cow (Bos taurus) [TaxId: 9913]}
slpqsfllkcleqvrkiqadgaelqerlcaahklchpeelmllrhslgipqaplsscssq
slqlrgclnqlhgglflyqgllqalagispelaptldtlqldvtdfatniwlqmedlgaa
pavqptqgamptftsafqrraggvlvasqlhrflelayrglryla

Sequence, based on observed residues (ATOM records):

>d1bgca_ a.26.1.1 (A:) Granulocyte-colony stimulating factor (G-CSF) {Cow (Bos taurus) [TaxId: 9913]}
slpqsfllkcleqvrkiqadgaelqerlcaahklchpeelmllrhslgipqaplsscssq
slqlrgclnqlhgglflyqgllqalagispelaptldtlqldvtdfatniwlqmedlgaa
pamptftsafqrraggvlvasqlhrflelayrglryla

Timeline for d1bgca_:

• d1bgca_ first appeared (with stable ids) in SCOP 1.55, called d1bgc__
  
• d1bgca_ appears in SCOPe 2.06