Lineage for d2uxqc_ (2uxq C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1619978Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1619979Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1620301Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 1620302Protein automated matches [190603] (13 species)
    not a true protein
  7. 1620338Species Desulfotalea psychrophila [TaxId:84980] [188344] (3 PDB entries)
  8. 1620341Domain d2uxqc_: 2uxq C: [168216]
    automated match to d1lwda_
    complexed with gol, mg, peg, so4

Details for d2uxqc_

PDB Entry: 2uxq (more details), 1.75 Å

PDB Description: isocitrate dehydrogenase from the psychrophilic bacterium desulfotalea psychrophila: biochemical properties and crystal structure analysis
PDB Compounds: (C:) isocitrate dehydrogenase native

SCOPe Domain Sequences for d2uxqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxqc_ c.77.1.0 (C:) automated matches {Desulfotalea psychrophila [TaxId: 84980]}
mkiqmktplveldgdemtrvlwplikdklllpfidlqteyydlgieerdrtndqitidaa
eaikkygvgvknatitpnqdrveeyglkeqwkspnatvramldgtvfrkpimvknikpsv
rswqkpivvgrhaygdfyknaeifaeaggkleivvtdkngketrqtimevdepaivqgih
ntvasighfaracfeysldqkidcwfatkdtiskqydqrfkiifeeifaqeykekfaaag
ieyfytliddvvarmmkteggmlwacknydgdvmsdmvasafgslammssvlvspygyfe
yeaahgtvqrhyyqhlkgertstnpvaliyawtgalrkrgeldgtpdlcafcdsleaiti
eciesgymtgdlaricepaaikvldsiefidelgkrlqqlnk

SCOPe Domain Coordinates for d2uxqc_:

Click to download the PDB-style file with coordinates for d2uxqc_.
(The format of our PDB-style files is described here.)

Timeline for d2uxqc_: