![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
![]() | Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) ![]() the constituent families form similar dimers |
![]() | Family c.77.1.0: automated matches [191423] (1 protein) not a true family |
![]() | Protein automated matches [190603] (13 species) not a true protein |
![]() | Species Desulfotalea psychrophila [TaxId:84980] [188344] (3 PDB entries) |
![]() | Domain d2uxqc_: 2uxq C: [168216] automated match to d1lwda_ complexed with gol, mg, peg, so4 |
PDB Entry: 2uxq (more details), 1.75 Å
SCOPe Domain Sequences for d2uxqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxqc_ c.77.1.0 (C:) automated matches {Desulfotalea psychrophila [TaxId: 84980]} mkiqmktplveldgdemtrvlwplikdklllpfidlqteyydlgieerdrtndqitidaa eaikkygvgvknatitpnqdrveeyglkeqwkspnatvramldgtvfrkpimvknikpsv rswqkpivvgrhaygdfyknaeifaeaggkleivvtdkngketrqtimevdepaivqgih ntvasighfaracfeysldqkidcwfatkdtiskqydqrfkiifeeifaqeykekfaaag ieyfytliddvvarmmkteggmlwacknydgdvmsdmvasafgslammssvlvspygyfe yeaahgtvqrhyyqhlkgertstnpvaliyawtgalrkrgeldgtpdlcafcdsleaiti eciesgymtgdlaricepaaikvldsiefidelgkrlqqlnk
Timeline for d2uxqc_: