SCOPe 2.01: Domain d2uxqb_: 2uxq B:

Lineage for d2uxqb_ (2uxq B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.0: automated matches [191423] (1 protein)
   not a true family

6. Protein automated matches [190603] (10 species)
   not a true protein

7. Species Desulfotalea psychrophila [TaxId:84980] [188344] (2 PDB entries)

8. Domain d2uxqb_: 2uxq B: [168215]
   automated match to d1lwda_
   complexed with gol, mg, peg, so4

Details for d2uxqb_

PDB Entry: 2uxq, 1.75 Å

PDB Description: isocitrate dehydrogenase from the psychrophilic bacterium desulfotalea psychrophila: biochemical properties and crystal structure analysis

PDB Compounds: (B:) isocitrate dehydrogenase native

SCOPe Domain Sequences for d2uxqb_:

Sequence; same for both SEQRES and ATOM records:

>d2uxqb_ c.77.1.0 (B:) automated matches {Desulfotalea psychrophila [TaxId: 84980]}
mkiqmktplveldgdemtrvlwplikdklllpfidlqteyydlgieerdrtndqitidaa
eaikkygvgvknatitpnqdrveeyglkeqwkspnatvramldgtvfrkpimvknikpsv
rswqkpivvgrhaygdfyknaeifaeaggkleivvtdkngketrqtimevdepaivqgih
ntvasighfaracfeysldqkidcwfatkdtiskqydqrfkiifeeifaqeykekfaaag
ieyfytliddvvarmmkteggmlwacknydgdvmsdmvasafgslammssvlvspygyfe
yeaahgtvqrhyyqhlkgertstnpvaliyawtgalrkrgeldgtpdlcafcdsleaiti
eciesgymtgdlaricepaaikvldsiefidelgkrlqqln

Timeline for d2uxqb_:

• d2uxqb_ is new in SCOPe 2.01-stable
  
• d2uxqb_ appears in SCOPe 2.02
  
• d2uxqb_ appears in the current release, SCOPe 2.08