SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2uxqa_ (2uxq A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138965Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2138966Protein automated matches [190603] (14 species)
    not a true protein
  7. 2139005Species Desulfotalea psychrophila [TaxId:84980] [188344] (3 PDB entries)
  8. 2139006Domain d2uxqa_: 2uxq A: [168214]
    automated match to d1lwda_
    complexed with gol, mg, peg, so4

Details for d2uxqa_

PDB Entry: 2uxq (more details), 1.75 Å

PDB Description: isocitrate dehydrogenase from the psychrophilic bacterium desulfotalea psychrophila: biochemical properties and crystal structure analysis
PDB Compounds: (A:) isocitrate dehydrogenase native

SCOPe Domain Sequences for d2uxqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxqa_ c.77.1.0 (A:) automated matches {Desulfotalea psychrophila [TaxId: 84980]}
mkiqmktplveldgdemtrvlwplikdklllpfidlqteyydlgieerdrtndqitidaa
eaikkygvgvknatitpnqdrveeyglkeqwkspnatvramldgtvfrkpimvknikpsv
rswqkpivvgrhaygdfyknaeifaeaggkleivvtdkngketrqtimevdepaivqgih
ntvasighfaracfeysldqkidcwfatkdtiskqydqrfkiifeeifaqeykekfaaag
ieyfytliddvvarmmkteggmlwacknydgdvmsdmvasafgslammssvlvspygyfe
yeaahgtvqrhyyqhlkgertstnpvaliyawtgalrkrgeldgtpdlcafcdsleaiti
eciesgymtgdlaricepaaikvldsiefidelgkrlqqlnk

SCOPe Domain Coordinates for d2uxqa_:

Click to download the PDB-style file with coordinates for d2uxqa_.
(The format of our PDB-style files is described here.)

Timeline for d2uxqa_: