![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein automated matches [190545] (9 species) not a true protein |
![]() | Species Achromobacter cycloclastes [TaxId:223] [188032] (5 PDB entries) |
![]() | Domain d2uxga_: 2uxg A: [168213] automated match to d1bqka_ complexed with cl, cu, gol |
PDB Entry: 2uxg (more details), 1.99 Å
SCOPe Domain Sequences for d2uxga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxga_ b.6.1.1 (A:) automated matches {Achromobacter cycloclastes [TaxId: 223]} adfevhmlnkgkdgamvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski nenykvtftapgvygvkctphpfmvgvvqvgdapanleavkgaknpkkaqerldaalaal gn
Timeline for d2uxga_: