| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
| Protein automated matches [190545] (9 species) not a true protein |
| Species Achromobacter cycloclastes [TaxId:223] [188032] (5 PDB entries) |
| Domain d2uxfa_: 2uxf A: [168212] automated match to d1bqka_ complexed with cl, cu, gol |
PDB Entry: 2uxf (more details), 2 Å
SCOPe Domain Sequences for d2uxfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxfa_ b.6.1.1 (A:) automated matches {Achromobacter cycloclastes [TaxId: 223]}
adfevhmlnkgkdgamvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
nenykvtftapgvygvkctphpfmvgvvqvgdapanleavkgaknpkkaqerldaalaal
gn
Timeline for d2uxfa_: