SCOPe 2.07: Domain d1gnca_: 1gnc A:

Lineage for d1gnca_ (1gnc A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 protein domains)

6. Protein Granulocyte-colony stimulating factor (G-CSF) [47268] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47269] (4 PDB entries)

8. Domain d1gnca_: 1gnc A: [16821]

Details for d1gnca_

PDB Entry: 1gnc

PDB Description: structure and dynamics of the human granulocyte colony-stimulating factor determined by nmr spectroscopy. loop mobility in a four-helix- bundle protein

PDB Compounds: (A:) granulocyte colony-stimulating factor

SCOPe Domain Sequences for d1gnca_:

Sequence, based on SEQRES records:

>d1gnca_ a.26.1.1 (A:) Granulocyte-colony stimulating factor (G-CSF) {Human (Homo sapiens) [TaxId: 9606]}
mtplgpasslpqsfllkcleqvrkiqgdgaalqeklvsecatyklchpeelvllghslgi
pwaplsscpsqalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfatt
iwqqmeelgmapalqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp

Sequence, based on observed residues (ATOM records):

>d1gnca_ a.26.1.1 (A:) Granulocyte-colony stimulating factor (G-CSF) {Human (Homo sapiens) [TaxId: 9606]}
mtplgpasslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwa
plsscpsqalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwq
qmeelgmapalqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp

Timeline for d1gnca_:

• d1gnca_ first appeared (with stable ids) in SCOP 1.55, called d1gnc__
  
• d1gnca_ appears in SCOPe 2.06