Lineage for d2uxaa_ (2uxa A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1185373Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1185374Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1185375Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1186093Protein automated matches [190140] (9 species)
    not a true protein
  7. 1186146Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (22 PDB entries)
  8. 1186174Domain d2uxaa_: 2uxa A: [168209]
    automated match to d1lb8a_
    complexed with glu, zn

Details for d2uxaa_

PDB Entry: 2uxa (more details), 2.38 Å

PDB Description: crystal structure of the glur2-flip ligand binding domain, r/g unedited.
PDB Compounds: (A:) glutamate receptor subunit glur2-flip

SCOPe Domain Sequences for d2uxaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxaa_ c.94.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
enktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgky
gardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpi
esaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarv
rkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrtpvnlavlkl
seqgvldklknkwwydkgecg

SCOPe Domain Coordinates for d2uxaa_:

Click to download the PDB-style file with coordinates for d2uxaa_.
(The format of our PDB-style files is described here.)

Timeline for d2uxaa_: