SCOPe 2.06: Domain d2ux7a_: 2ux7 A:

Lineage for d2ux7a_ (2ux7 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein automated matches [190545] (8 species)
   not a true protein

7. Species Achromobacter cycloclastes [TaxId:223] [188032] (5 PDB entries)

8. Domain d2ux7a_: 2ux7 A: [168208]
   automated match to d1bqka_
   complexed with cl, cu, gol

Details for d2ux7a_

PDB Entry: 2ux7, 1.3 Å

PDB Description: pseudoazurin with engineered amicyanin ligand loop, reduced form, ph 7.5

PDB Compounds: (A:) pseudoazurin

SCOPe Domain Sequences for d2ux7a_:

Sequence; same for both SEQRES and ATOM records:

>d2ux7a_ b.6.1.1 (A:) automated matches {Achromobacter cycloclastes [TaxId: 223]}
adfevhmlnkgkdgamvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
nenykvtftapgvygvkctphpfmvgvvqvgdapanleavkgaknpkkaqerldaalaal
gn

Timeline for d2ux7a_:

• d2ux7a_ first appeared in SCOPe 2.01
  
• d2ux7a_ appears in SCOPe 2.05
  
• d2ux7a_ appears in SCOPe 2.07
  
• d2ux7a_ appears in the current release, SCOPe 2.08