Lineage for d2uwcb_ (2uwc B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2044115Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2044116Protein automated matches [190437] (53 species)
    not a true protein
  7. 2044506Species Tropaeolum majus [TaxId:4020] [187334] (4 PDB entries)
  8. 2044515Domain d2uwcb_: 2uwc B: [168199]
    automated match to d1umza_

Details for d2uwcb_

PDB Entry: 2uwc (more details), 2.3 Å

PDB Description: crystal structure of nasturtium xyloglucan hydrolase isoform nxg2
PDB Compounds: (B:) cellulase

SCOPe Domain Sequences for d2uwcb_:

Sequence, based on SEQRES records: (download)

>d2uwcb_ b.29.1.0 (B:) automated matches {Tropaeolum majus [TaxId: 4020]}
ppspgyypssqitslgfdqgytnlwgpqhqrvdqgsltiwldstsgsgfksinryrsgyf
ganiklqsgytagvitsfylsnnqdypgkhdeidieflgtipgkpytlqtnvfiegsgdy
niigrelrihlwfdptqdyhnyaiywtpseiiffvddvpirryprksdatfplrpmwvyg
svwdasswatengkykadyryqpfvgkyedfklgsctveaasscnpasvspygqlsqqqv
aamewvqknymvynycddptrdhtltpec

Sequence, based on observed residues (ATOM records): (download)

>d2uwcb_ b.29.1.0 (B:) automated matches {Tropaeolum majus [TaxId: 4020]}
ppspgyypssqitslgfdqgytnlwgpqhqrvdqgsltiwldstsgsgfksinryrsgyf
ganiklqsgytagvitsfylsnnqdypgkhdeidieflgtipgkpytlqtnvfiegsgdy
niigrelrihlwfdptqdyhnyaiywtpseiiffvddvpirryprksdatfplrpmwvyg
svwdasswatykadyryqpfvgkyedfklgsctveaasscnpasvspygqlsqqqvaame
wvqknymvynycddptrdhtltpec

SCOPe Domain Coordinates for d2uwcb_:

Click to download the PDB-style file with coordinates for d2uwcb_.
(The format of our PDB-style files is described here.)

Timeline for d2uwcb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2uwca_