SCOPe 2.08: Domain d2uwbb_: 2uwb B:

Lineage for d2uwbb_ (2uwb B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Tropaeolum majus [TaxId:4020] [187334] (4 PDB entries)

8. Domain d2uwbb_: 2uwb B: [168197]
   automated match to d1umzb_
   mutant

Details for d2uwbb_

PDB Entry: 2uwb, 2 Å

PDB Description: crystal structure of the nasturtium seedling mutant xyloglucanase isoform nxg1-delta-yniig

PDB Compounds: (B:) cellulase

SCOPe Domain Sequences for d2uwbb_:

Sequence; same for both SEQRES and ATOM records:

>d2uwbb_ b.29.1.0 (B:) automated matches {Tropaeolum majus [TaxId: 4020]}
vqgppspgyypssqitslgfdqgytnlwgpqhqrvdqgsltiwldstsgsgfksinryrs
gyfganiklqsgytagvitsfylsnnqdypgkhdeidieflgtipgkpytlqtnvfiegs
gdremrihlwfdptqdyhnyaiywtpseiiffvddvpirryprksdatfplrplwvygsv
wdasswatengkykadyryqpfvgkyedfklgsctveaasscnpasvspygqlsqqqvaa
mewvqknymvynycddptrdhtltpec

Timeline for d2uwbb_:

• d2uwbb_ first appeared in SCOPe 2.01
  
• d2uwbb_ appears in SCOPe 2.07