![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
![]() | Protein automated matches [190435] (12 species) not a true protein |
![]() | Species Hedera helix [TaxId:4052] [187347] (1 PDB entry) |
![]() | Domain d2uw1a_: 2uw1 A: [168185] automated match to d1afra_ complexed with fe, gvm, na |
PDB Entry: 2uw1 (more details), 1.95 Å
SCOPe Domain Sequences for d2uw1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uw1a_ a.25.1.2 (A:) automated matches {Hedera helix [TaxId: 4052]} leifkslddwarnnvlihlksvekswqpqdylpdpvsdgfeeqvrelrerakeipddyfv vlvgdmiteealptymsmlnrcdgikdetgaepsawamwtrawtaeenrhgdllnkylyl sgrvdmrkiektiqyligsgmdiksenspylgfiytsfqeratfishantaklaqhygdk klahicgsiasdekrhataytkiveklaeidpdttviafadmmrkkitmpahlmydgsde llfkhftavaqrlgvysaldycdileflvdkwnverltglsdegrkaqeyvcelgpkirr leeraqgrakeaptmpfswifdrqvkl
Timeline for d2uw1a_: