SCOPe 2.08: Domain d2uw1a_: 2uw1 A:

Lineage for d2uw1a_ (2uw1 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein automated matches [190435] (12 species)
   not a true protein

7. Species Hedera helix [TaxId:4052] [187347] (1 PDB entry)

8. Domain d2uw1a_: 2uw1 A: [168185]
   automated match to d1afra_
   complexed with fe, gvm, na

Details for d2uw1a_

PDB Entry: 2uw1, 1.95 Å

PDB Description: ivy desaturase structure

PDB Compounds: (A:) plastid delta4 multifunctional acyl-acyl carrier protein desaturase

SCOPe Domain Sequences for d2uw1a_:

Sequence; same for both SEQRES and ATOM records:

>d2uw1a_ a.25.1.2 (A:) automated matches {Hedera helix [TaxId: 4052]}
leifkslddwarnnvlihlksvekswqpqdylpdpvsdgfeeqvrelrerakeipddyfv
vlvgdmiteealptymsmlnrcdgikdetgaepsawamwtrawtaeenrhgdllnkylyl
sgrvdmrkiektiqyligsgmdiksenspylgfiytsfqeratfishantaklaqhygdk
klahicgsiasdekrhataytkiveklaeidpdttviafadmmrkkitmpahlmydgsde
llfkhftavaqrlgvysaldycdileflvdkwnverltglsdegrkaqeyvcelgpkirr
leeraqgrakeaptmpfswifdrqvkl

Timeline for d2uw1a_:

• d2uw1a_ first appeared in SCOPe 2.01
  
• d2uw1a_ appears in SCOPe 2.07