SCOPe 2.08: Domain d2uuxa_: 2uux A:

Lineage for d2uuxa_ (2uux A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.3: Tick tryptase inhibitor-like [161132] (2 proteins)

6. Protein automated matches [190783] (1 species)
   not a true protein

7. Species Brown ear tick (Rhipicephalus appendiculatus) [TaxId:34631] [188030] (3 PDB entries)

8. Domain d2uuxa_: 2uux A: [168179]
   automated match to d2uuyb1
   complexed with so4

Details for d2uuxa_

PDB Entry: 2uux, 1.4 Å

PDB Description: structure of the tryptase inhibitor tdpi from a tick

PDB Compounds: (A:) tryptase inhibitor

SCOPe Domain Sequences for d2uuxa_:

Sequence; same for both SEQRES and ATOM records:

>d2uuxa_ g.8.1.3 (A:) automated matches {Brown ear tick (Rhipicephalus appendiculatus) [TaxId: 34631]}
aaectvpigwsepvkglckarftryycmgncckvyegcytggysrmgecarncpg

Timeline for d2uuxa_:

• d2uuxa_ first appeared in SCOPe 2.01
  
• d2uuxa_ appears in SCOPe 2.07