Lineage for d2uusb_ (2uus B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1316302Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1316303Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 1316304Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 1316570Protein automated matches [190637] (2 species)
    not a true protein
  7. 1316573Species Norway rat (Rattus norvegicus) [TaxId:10116] [188437] (2 PDB entries)
  8. 1316577Domain d2uusb_: 2uus B: [168178]
    automated match to d1djsb_
    complexed with scr

Details for d2uusb_

PDB Entry: 2uus (more details), 2.2 Å

PDB Description: crystal structure of the rat fgf1-sucrose octasulfate (sos) complex.
PDB Compounds: (B:) heparin-binding growth factor 1

SCOPe Domain Sequences for d2uusb_:

Sequence, based on SEQRES records: (download)

>d2uusb_ b.42.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesagevyikgtetgqylam
dtegllygsqtpneeclflerleenhyntytskkhaeknwfvglkkngsckrgprthygq
kailflplpvs

Sequence, based on observed residues (ATOM records): (download)

>d2uusb_ b.42.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaegevyikgtetgqylamdt
egllygsqtpneeclflerleenhyntytskkhaeknwfvglkkngsckrgprthygqka
ilflplpvs

SCOPe Domain Coordinates for d2uusb_:

Click to download the PDB-style file with coordinates for d2uusb_.
(The format of our PDB-style files is described here.)

Timeline for d2uusb_: