Class b: All beta proteins [48724] (174 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) |
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins) |
Protein automated matches [190637] (2 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [188437] (1 PDB entry) |
Domain d2uusb_: 2uus B: [168178] automated match to d1djsb_ complexed with scr |
PDB Entry: 2uus (more details), 2.2 Å
SCOPe Domain Sequences for d2uusb_:
Sequence, based on SEQRES records: (download)
>d2uusb_ b.42.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesagevyikgtetgqylam dtegllygsqtpneeclflerleenhyntytskkhaeknwfvglkkngsckrgprthygq kailflplpvs
>d2uusb_ b.42.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaegevyikgtetgqylamdt egllygsqtpneeclflerleenhyntytskkhaeknwfvglkkngsckrgprthygqka ilflplpvs
Timeline for d2uusb_: