SCOPe 2.08: Domain d2uusb_: 2uus B:

Lineage for d2uusb_ (2uus B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein automated matches [190637] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [188437] (2 PDB entries)

8. Domain d2uusb_: 2uus B: [168178]
   automated match to d1djsb_

Details for d2uusb_

PDB Entry: 2uus, 2.2 Å

PDB Description: crystal structure of the rat fgf1-sucrose octasulfate (sos) complex.

PDB Compounds: (B:) heparin-binding growth factor 1

SCOPe Domain Sequences for d2uusb_:

Sequence, based on SEQRES records:

>d2uusb_ b.42.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesagevyikgtetgqylam
dtegllygsqtpneeclflerleenhyntytskkhaeknwfvglkkngsckrgprthygq
kailflplpvs

Sequence, based on observed residues (ATOM records):

>d2uusb_ b.42.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaegevyikgtetgqylamdt
egllygsqtpneeclflerleenhyntytskkhaeknwfvglkkngsckrgprthygqka
ilflplpvs

Timeline for d2uusb_:

• d2uusb_ first appeared in SCOPe 2.01
  
• d2uusb_ appears in SCOPe 2.07