SCOPe 2.08: Domain d2rlca_: 2rlc A:

Lineage for d2rlca_ (2rlc A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (19 species)
   not a true protein

7. Species Clostridium perfringens [TaxId:1502] [188628] (5 PDB entries)

8. Domain d2rlca_: 2rlc A: [168176]
   automated match to d3pvaa_
   complexed with chd, gly, so4

Details for d2rlca_

PDB Entry: 2rlc, 1.8 Å

PDB Description: Crystal Structure of the Conjugated Bile Acid Hydrolase from Clostridium perfringens in Complex with Reaction Products Glycine and Cholate

PDB Compounds: (A:) choloylglycine hydrolase

SCOPe Domain Sequences for d2rlca_:

Sequence; same for both SEQRES and ATOM records:

>d2rlca_ d.153.1.0 (A:) automated matches {Clostridium perfringens [TaxId: 1502]}
ctglaletkdglhlfgrnmdieysfnqsiifiprnfkcvnksnkkelttkyavlgmgtif
ddyptfadgmnekglgcaglnfpvyvsyskediegktnipvynfllwvlanfssveevke
alknanivdipisenipnttlhwmisditgksivveqtkeklnvfdnnigvltnsptfdw
hvanlnqyvglrynqvpefklgdqsltalgqgtglvglpgdftpasrfirvaflrdamik
ndkdsidlieffhilnnvamvrgstrtveeksdltqytscmclekgiyyyntyennqina
idmnkenldgneiktykynktlsinhvn

Timeline for d2rlca_:

• d2rlca_ first appeared in SCOPe 2.01
  
• d2rlca_ appears in SCOPe 2.07