Lineage for d2rkbb_ (2rkb B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2156898Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2156899Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2157251Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2157252Protein automated matches [190215] (33 species)
    not a true protein
  7. 2157310Species Human (Homo sapiens) [TaxId:9606] [188411] (3 PDB entries)
  8. 2157314Domain d2rkbb_: 2rkb B: [168161]
    automated match to d1pwha_
    complexed with k, plp

Details for d2rkbb_

PDB Entry: 2rkb (more details), 2.8 Å

PDB Description: serine dehydratase like-1 from human cancer cells
PDB Compounds: (B:) Serine dehydratase-like

SCOPe Domain Sequences for d2rkbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rkbb_ c.79.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qepfhvvtplleswalsqvagmpvflkcenvqpsgsfkirgighfcqemakkgcrhlvcs
sggnagiaaayaarklgipativlpestslqvvqrlqgegaevqltgkvwdeanlraqel
akrdgwenvppfdhpliwkghaslvqelkavlrtppgalvlavggggllagvvagllevg
wqhvpiiamethgahcfnaaitagklvtlpditsvakslgaktvaaralecmqvckihse
vvedteavsavqqllddermlvepacgaalaaiysgllrrlqaegclppsltsvvvivcg
gnninsrelqalkthlgq

SCOPe Domain Coordinates for d2rkbb_:

Click to download the PDB-style file with coordinates for d2rkbb_.
(The format of our PDB-style files is described here.)

Timeline for d2rkbb_: