SCOP 1.59: Domain d1cd9c_: 1cd9 C:

Lineage for d1cd9c_ (1cd9 C:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)

5. Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)

6. Protein Granulocyte-colony stimulating factor (G-CSF) [47268] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47269] (4 PDB entries)

8. Domain d1cd9c_: 1cd9 C: [16816]
   Other proteins in same PDB: d1cd9b1, d1cd9b2, d1cd9d1, d1cd9d2

Details for d1cd9c_

PDB Entry: 1cd9, 2.8 Å

PDB Description: 2:2 complex of g-csf with its receptor

SCOP Domain Sequences for d1cd9c_:

Sequence; same for both SEQRES and ATOM records:

>d1cd9c_ a.26.1.1 (C:) Granulocyte-colony stimulating factor (G-CSF) {Human (Homo sapiens)}
asslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplsscp
sqalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmeelg
mapalqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp

Timeline for d1cd9c_:

• d1cd9c_ first appeared (with stable ids) in SCOP 1.55
  
• d1cd9c_ appears in SCOP 1.57
  
• d1cd9c_ appears in SCOP 1.61
  
• d1cd9c_ appears in the current release, SCOPe 2.08