| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily) 3 short helices; irregular array |
Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families) ![]() |
| Family a.14.1.1: VHP, Villin headpiece domain [47051] (5 proteins) |
| Protein Villin [47052] (2 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [47053] (13 PDB entries) |
| Domain d2rjxb_: 2rjx B: [168156] automated match to d1qqva_ |
PDB Entry: 2rjx (more details), 1.7 Å
SCOPe Domain Sequences for d2rjxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rjxb_ a.14.1.1 (B:) Villin {Chicken (Gallus gallus) [TaxId: 9031]}
letfpldvlvntaaedlprgvdpsrkenhlsdedfkavfgmtrsafanlplwkqqnlkke
kglf
Timeline for d2rjxb_: