SCOPe 2.08: Domain d2rjxa_: 2rjx A:

Lineage for d2rjxa_ (2rjx A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
   3 short helices; irregular array

4. Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families)

5. Family a.14.1.1: VHP, Villin headpiece domain [47051] (5 proteins)

6. Protein Villin [47052] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47053] (13 PDB entries)

8. Domain d2rjxa_: 2rjx A: [168155]
   automated match to d1qqva_

Details for d2rjxa_

PDB Entry: 2rjx, 1.7 Å

PDB Description: Crystal structure of the headpiece domain of chicken villin, P61 space group

PDB Compounds: (A:) Villin-1

SCOPe Domain Sequences for d2rjxa_:

Sequence; same for both SEQRES and ATOM records:

>d2rjxa_ a.14.1.1 (A:) Villin {Chicken (Gallus gallus) [TaxId: 9031]}
ptkletfpldvlvntaaedlprgvdpsrkenhlsdedfkavfgmtrsafanlplwkqqnl
kkekglf

Timeline for d2rjxa_:

• d2rjxa_ first appeared in SCOPe 2.01
  
• d2rjxa_ appears in SCOPe 2.07