SCOPe 2.05: Domain d2rjwb_: 2rjw B:

Lineage for d2rjwb_ (2rjw B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
   3 short helices; irregular array

4. Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families)

5. Family a.14.1.1: VHP, Villin headpiece domain [47051] (5 proteins)

6. Protein Villin [47052] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47053] (13 PDB entries)

8. Domain d2rjwb_: 2rjw B: [168154]
   automated match to d1qqva_
   mutant

Details for d2rjwb_

PDB Entry: 2rjw, 1.55 Å

PDB Description: the crystal structure of the h41y mutant of villin headpiece, p61 space group.

PDB Compounds: (B:) Villin-1

SCOPe Domain Sequences for d2rjwb_:

Sequence; same for both SEQRES and ATOM records:

>d2rjwb_ a.14.1.1 (B:) Villin {Chicken (Gallus gallus) [TaxId: 9031]}
ptkletfpldvlvntaaedlprgvdpsrkenylsdedfkavfgmtrsafanlplwkqqnl
kkekglf

Timeline for d2rjwb_:

• d2rjwb_ first appeared in SCOPe 2.01
  
• d2rjwb_ appears in SCOPe 2.04
  
• d2rjwb_ appears in SCOPe 2.06
  
• d2rjwb_ appears in the current release, SCOPe 2.08