Lineage for d2rjwb_ (2rjw B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697673Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
    3 short helices; irregular array
  4. 2697674Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families) (S)
  5. 2697675Family a.14.1.1: VHP, Villin headpiece domain [47051] (5 proteins)
  6. 2697685Protein Villin [47052] (2 species)
  7. 2697686Species Chicken (Gallus gallus) [TaxId:9031] [47053] (13 PDB entries)
  8. 2697694Domain d2rjwb_: 2rjw B: [168154]
    automated match to d1qqva_
    mutant

Details for d2rjwb_

PDB Entry: 2rjw (more details), 1.55 Å

PDB Description: the crystal structure of the h41y mutant of villin headpiece, p61 space group.
PDB Compounds: (B:) Villin-1

SCOPe Domain Sequences for d2rjwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rjwb_ a.14.1.1 (B:) Villin {Chicken (Gallus gallus) [TaxId: 9031]}
ptkletfpldvlvntaaedlprgvdpsrkenylsdedfkavfgmtrsafanlplwkqqnl
kkekglf

SCOPe Domain Coordinates for d2rjwb_:

Click to download the PDB-style file with coordinates for d2rjwb_.
(The format of our PDB-style files is described here.)

Timeline for d2rjwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2rjwa_