SCOPe 2.08: Domain d2rjwa_: 2rjw A:

Lineage for d2rjwa_ (2rjw A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
   3 short helices; irregular array

4. Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families)

5. Family a.14.1.1: VHP, Villin headpiece domain [47051] (5 proteins)

6. Protein Villin [47052] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47053] (13 PDB entries)

8. Domain d2rjwa_: 2rjw A: [168153]
   automated match to d1qqva_
   mutant

Details for d2rjwa_

PDB Entry: 2rjw, 1.55 Å

PDB Description: the crystal structure of the h41y mutant of villin headpiece, p61 space group.

PDB Compounds: (A:) Villin-1

SCOPe Domain Sequences for d2rjwa_:

Sequence; same for both SEQRES and ATOM records:

>d2rjwa_ a.14.1.1 (A:) Villin {Chicken (Gallus gallus) [TaxId: 9031]}
ptkletfpldvlvntaaedlprgvdpsrkenylsdedfkavfgmtrsafanlplwkqqnl
kkekglf

Timeline for d2rjwa_:

• d2rjwa_ first appeared in SCOPe 2.01
  
• d2rjwa_ appears in SCOPe 2.07