Lineage for d1cd9a_ (1cd9 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46942Fold a.26: 4-helical cytokines [47265] (1 superfamily)
  4. 46943Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
  5. 46944Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)
  6. 46951Protein Granulocyte-colony stimulating factor (G-CSF) [47268] (3 species)
  7. 46958Species Human (Homo sapiens) [TaxId:9606] [47269] (4 PDB entries)
  8. 46962Domain d1cd9a_: 1cd9 A: [16815]
    Other proteins in same PDB: d1cd9b1, d1cd9b2, d1cd9d1, d1cd9d2

Details for d1cd9a_

PDB Entry: 1cd9 (more details), 2.8 Å

PDB Description: 2:2 complex of g-csf with its receptor

SCOP Domain Sequences for d1cd9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cd9a_ a.26.1.1 (A:) Granulocyte-colony stimulating factor (G-CSF) {Human (Homo sapiens)}
gpasslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplss
cpsqalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmee
lgmapalqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp

SCOP Domain Coordinates for d1cd9a_:

Click to download the PDB-style file with coordinates for d1cd9a_.
(The format of our PDB-style files is described here.)

Timeline for d1cd9a_: