SCOPe 2.08: Domain d2rj3a_: 2rj3 A:

Lineage for d2rj3a_ (2rj3 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Uridine phosphorylase [53176] (6 species)

7. Species Salmonella typhimurium [TaxId:90371] [117656] (24 PDB entries)
   Uniprot P0A1F6

8. Domain d2rj3a_: 2rj3 A: [168143]
   automated match to d1ryza_
   complexed with po4, ura

Details for d2rj3a_

PDB Entry: 2rj3, 2.51 Å

PDB Description: Crystal Structure of the Uridine Phosphorylase from Salmonella Typhimurium in Complex with Uracil and Phosphate Ion at 2.49A Resolution

PDB Compounds: (A:) Uridine phosphorylase

SCOPe Domain Sequences for d2rj3a_:

Sequence; same for both SEQRES and ATOM records:

>d2rj3a_ c.56.2.1 (A:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

Timeline for d2rj3a_:

• d2rj3a_ first appeared in SCOPe 2.01
  
• d2rj3a_ appears in SCOPe 2.07