Lineage for d2rj2a1 (2rj2 A:117-297)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384519Family b.18.1.21: F-box associated region, FBA [101585] (2 proteins)
    automatically mapped to Pfam PF04300
  6. 2384524Protein automated matches [190275] (1 species)
    not a true protein
  7. 2384525Species Mouse (Mus musculus) [TaxId:10090] [187067] (3 PDB entries)
  8. 2384526Domain d2rj2a1: 2rj2 A:117-297 [168142]
    Other proteins in same PDB: d2rj2a2
    automated match to d1umha_
    complexed with cl, ni

Details for d2rj2a1

PDB Entry: 2rj2 (more details), 1.7 Å

PDB Description: Crystal Structure of the Sugar Recognizing SCF Ubiquitin Ligase at 1.7 Resolution
PDB Compounds: (A:) F-box only protein 2

SCOPe Domain Sequences for d2rj2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rj2a1 b.18.1.21 (A:117-297) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
fyflskrrrnllrnpcgeedlegwsdvehggdgwkveelpgdgnveftqddsvkkyfass
fewcrkaqvidlqaegyweelldttqpaivvkdwysgrtdagslyeltvrllsenedvla
efatgqvavpedgswmeishtfidygpgvrfvrfehggqdsvywkgwfgarvtnssvwve
p

SCOPe Domain Coordinates for d2rj2a1:

Click to download the PDB-style file with coordinates for d2rj2a1.
(The format of our PDB-style files is described here.)

Timeline for d2rj2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rj2a2