Lineage for d2riix_ (2rii X:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1052512Fold d.268: ParB/Sulfiredoxin [110848] (1 superfamily)
    beta*-alpha-beta(2)-alpha-beta-alpha; mixed beta sheet forms a partly open barrel: (n*=4, S*=8)
  4. 1052513Superfamily d.268.1: ParB/Sulfiredoxin [110849] (4 families) (S)
  5. 1052540Family d.268.1.4: Sulfiredoxin-like [160095] (2 proteins)
    PfamB PB015736
  6. 1052541Protein Sulfiredoxin [160096] (1 species)
  7. 1052542Species Human (Homo sapiens) [TaxId:9606] [160097] (6 PDB entries)
    Uniprot Q9BYN0 17-137! Uniprot Q9BYN0 28-137! Uniprot Q9BYN0 30-137
  8. 1052546Domain d2riix_: 2rii X: [168137]
    automated match to d1xw4x1
    complexed with po4

Details for d2riix_

PDB Entry: 2rii (more details), 2.6 Å

PDB Description: crystal structure of human peroxiredoxin i in complex with sulfiredoxin
PDB Compounds: (X:) Sulfiredoxin-1

SCOPe Domain Sequences for d2riix_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2riix_ d.268.1.4 (X:) Sulfiredoxin {Human (Homo sapiens) [TaxId: 9606]}
sihsgriaavhnvplsvlirplpsvldpakvqslvdtiredpdsvppidvlwikgaqggd
yfysfggchryaayqqlqretipaklvqstlsdlrvylgastpdlq

SCOPe Domain Coordinates for d2riix_:

Click to download the PDB-style file with coordinates for d2riix_.
(The format of our PDB-style files is described here.)

Timeline for d2riix_: