Lineage for d2ri4k_ (2ri4 K:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688661Species Goat (Capra hircus) [TaxId:9925] [188635] (3 PDB entries)
  8. 2688672Domain d2ri4k_: 2ri4 K: [168135]
    automated match to d1fsxa_
    complexed with hem

Details for d2ri4k_

PDB Entry: 2ri4 (more details), 2.7 Å

PDB Description: crystal structure determination of goat methemoglobin at 2.7 angstrom
PDB Compounds: (K:) Hemoglobin subunit alpha-1/2

SCOPe Domain Sequences for d2ri4k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ri4k_ a.1.1.2 (K:) automated matches {Goat (Capra hircus) [TaxId: 9925]}
lsaadksnvkaawgkvggnagaygaealermflsfpttktyfphfdlshgsaqvkghgek
vaaaltkavghlddlpgtlsdlsdlhahklrvdpvnfkllshsllvtlachlpndftpav
hasldkflanvstvltsk

SCOPe Domain Coordinates for d2ri4k_:

Click to download the PDB-style file with coordinates for d2ri4k_.
(The format of our PDB-style files is described here.)

Timeline for d2ri4k_: