Lineage for d2ri4d_ (2ri4 D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1978657Protein automated matches [190359] (42 species)
    not a true protein
  7. 1978839Species Goat (Capra hircus) [TaxId:9925] [188635] (3 PDB entries)
  8. 1978847Domain d2ri4d_: 2ri4 D: [168132]
    automated match to d1fsxb_
    complexed with hem

Details for d2ri4d_

PDB Entry: 2ri4 (more details), 2.7 Å

PDB Description: crystal structure determination of goat methemoglobin at 2.7 angstrom
PDB Compounds: (D:) Hemoglobin subunit beta-A

SCOPe Domain Sequences for d2ri4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ri4d_ a.1.1.2 (D:) automated matches {Goat (Capra hircus) [TaxId: 9925]}
mltaeekaavtgfwgkvkvdevgaealgrllvvypwtqrffehfgdlssadavmnnakvk
ahgkkvldsfsngmkhlddlkgtfaqlselhcdklhvdpenfkllgnvlvvvlarhhgse
ftpllqaefqkvvagvanalahry

SCOPe Domain Coordinates for d2ri4d_:

Click to download the PDB-style file with coordinates for d2ri4d_.
(The format of our PDB-style files is described here.)

Timeline for d2ri4d_: