Lineage for d2ri4c_ (2ri4 C:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903555Protein automated matches [190359] (30 species)
    not a true protein
  7. 903682Species Goat (Capra hircus) [TaxId:9925] [188635] (2 PDB entries)
  8. 903689Domain d2ri4c_: 2ri4 C: [168131]
    automated match to d1fsxa_
    complexed with hem

Details for d2ri4c_

PDB Entry: 2ri4 (more details), 2.7 Å

PDB Description: crystal structure determination of goat methemoglobin at 2.7 angstrom
PDB Compounds: (C:) Hemoglobin subunit alpha-1/2

SCOPe Domain Sequences for d2ri4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ri4c_ a.1.1.2 (C:) automated matches {Goat (Capra hircus) [TaxId: 9925]}
lsaadksnvkaawgkvggnagaygaealermflsfpttktyfphfdlshgsaqvkghgek
vaaaltkavghlddlpgtlsdlsdlhahklrvdpvnfkllshsllvtlachlpndftpav
hasldkflanvstvltsk

SCOPe Domain Coordinates for d2ri4c_:

Click to download the PDB-style file with coordinates for d2ri4c_.
(The format of our PDB-style files is described here.)

Timeline for d2ri4c_: