SCOPe 2.08: Domain d1rhgb_: 1rhg B:

Lineage for d1rhgb_ (1rhg B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)

6. Protein Granulocyte-colony stimulating factor (G-CSF) [47268] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47269] (4 PDB entries)

8. Domain d1rhgb_: 1rhg B: [16813]

Details for d1rhgb_

PDB Entry: 1rhg, 2.2 Å

PDB Description: the structure of granulocyte-colony-stimulating factor and its relationship to those of other growth factors

PDB Compounds: (B:) granulocyte colony-stimulating factor

SCOPe Domain Sequences for d1rhgb_:

Sequence, based on SEQRES records:

>d1rhgb_ a.26.1.1 (B:) Granulocyte-colony stimulating factor (G-CSF) {Human (Homo sapiens) [TaxId: 9606]}
lpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplsscpsqa
lqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmeelgmap
alqptqgampafasafqrraggvlvashlqsflevsyrvlrhla

Sequence, based on observed residues (ATOM records):

>d1rhgb_ a.26.1.1 (B:) Granulocyte-colony stimulating factor (G-CSF) {Human (Homo sapiens) [TaxId: 9606]}
lpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplssclagc
lsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmempafasafqrra
ggvlvashlqsflevsyrvlrhla

Timeline for d1rhgb_:

• d1rhgb_ first appeared (with stable ids) in SCOP 1.55
  
• d1rhgb_ appears in SCOPe 2.07