| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein automated matches [190359] (43 species) not a true protein |
| Species Goat (Capra hircus) [TaxId:9925] [188635] (3 PDB entries) |
| Domain d2ri4a_: 2ri4 A: [168129] automated match to d1fsxa_ complexed with hem |
PDB Entry: 2ri4 (more details), 2.7 Å
SCOPe Domain Sequences for d2ri4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ri4a_ a.1.1.2 (A:) automated matches {Goat (Capra hircus) [TaxId: 9925]}
vlsaadksnvkaawgkvggnagaygaealermflsfpttktyfphfdlshgsaqvkghge
kvaaaltkavghlddlpgtlsdlsdlhahklrvdpvnfkllshsllvtlachlpndftpa
vhasldkflanvstvltsk
Timeline for d2ri4a_: