Lineage for d2rhrb_ (2rhr B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 975436Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 975639Protein beta-keto acyl carrier protein reductase [51788] (8 species)
  7. 975668Species Streptomyces coelicolor [TaxId:1902] [117408] (8 PDB entries)
    Uniprot P16544 #SP
  8. 975681Domain d2rhrb_: 2rhr B: [168128]
    automated match to d1w4zb_
    complexed with emo, nap; mutant

Details for d2rhrb_

PDB Entry: 2rhr (more details), 2.5 Å

PDB Description: p94l actinorhodin ketordeuctase mutant, with nadph and inhibitor emodin
PDB Compounds: (B:) Actinorhodin Polyketide Ketoreductase

SCOPe Domain Sequences for d2rhrb_:

Sequence, based on SEQRES records: (download)

>d2rhrb_ c.2.1.2 (B:) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]}
gshmatqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagvea
dgrtcdvrsvpeiealvaavverygpvdvlvnnagrlgggataeladelwldvvetnltg
vfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelar
tgitvnavcpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpsevaemva
yligpgaaavtaqalnvcgglgny

Sequence, based on observed residues (ATOM records): (download)

>d2rhrb_ c.2.1.2 (B:) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]}
gshmatqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagvea
dgrtcdvrsvpeiealvaavverygpvdvlvnnagrlgggataeladelwldvvetnltg
vfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelar
tgitvnavcpgfvetpmaasvrehteeafdritarvpigryvqpsevaemvayligpgaa
avtaqalnvcgglgny

SCOPe Domain Coordinates for d2rhrb_:

Click to download the PDB-style file with coordinates for d2rhrb_.
(The format of our PDB-style files is described here.)

Timeline for d2rhrb_: