Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein beta-keto acyl carrier protein reductase [51788] (8 species) |
Species Streptomyces coelicolor [TaxId:1902] [117408] (8 PDB entries) Uniprot P16544 #SP |
Domain d2rhra_: 2rhr A: [168127] Other proteins in same PDB: d2rhrb2 automated match to d1w4zb_ complexed with emo, ndp; mutant |
PDB Entry: 2rhr (more details), 2.5 Å
SCOPe Domain Sequences for d2rhra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rhra_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} sevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagveadgrtcdvr svpeiealvaavverygpvdvlvnnagrlgggataeladelwldvvetnltgvfrvtkqv lkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelartgitvnav cpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpsevaemvayligpgaa avtaqalnvcgglgny
Timeline for d2rhra_: