Lineage for d2rhda_ (2rhd A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846955Protein automated matches [190047] (27 species)
    not a true protein
  7. 1846986Species Cryptosporidium parvum [TaxId:5807] [188236] (1 PDB entry)
  8. 1846987Domain d2rhda_: 2rhd A: [168124]
    automated match to d2fola1
    complexed with gdp, mg

Details for d2rhda_

PDB Entry: 2rhd (more details), 2.06 Å

PDB Description: Crystal structure of Cryptosporidium parvum small GTPase RAB1A
PDB Compounds: (A:) Small GTP binding protein rab1a

SCOPe Domain Sequences for d2rhda_:

Sequence, based on SEQRES records: (download)

>d2rhda_ c.37.1.8 (A:) automated matches {Cryptosporidium parvum [TaxId: 5807]}
npeydylfkllligdsgvgksclllrfaddtytdsyistigvdfkirtislenktvklqi
wdtagqerfrtitssyyrgahgiiivydvtdrdsfdnvkqwiqeidryamenvnkllvgn
kcdlvskrvvtsdegreladshgikfietsaknaynveqafhtmageikkrvq

Sequence, based on observed residues (ATOM records): (download)

>d2rhda_ c.37.1.8 (A:) automated matches {Cryptosporidium parvum [TaxId: 5807]}
npeydylfkllligdsgvgksclllrfaddtytdsyistigvdfkirtislenktvklqi
wdtagsyyrgahgiiivydvtdrdsfdnvkqwiqeidryamenvnkllvgnkcdlvskrv
vtsdegreladshgikfietsaknaynveqafhtmageikkrvq

SCOPe Domain Coordinates for d2rhda_:

Click to download the PDB-style file with coordinates for d2rhda_.
(The format of our PDB-style files is described here.)

Timeline for d2rhda_: