Lineage for d1rhga_ (1rhg A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 639436Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 639437Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 639438Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)
  6. 639445Protein Granulocyte-colony stimulating factor (G-CSF) [47268] (3 species)
  7. 639452Species Human (Homo sapiens) [TaxId:9606] [47269] (5 PDB entries)
  8. 639453Domain d1rhga_: 1rhg A: [16812]

Details for d1rhga_

PDB Entry: 1rhg (more details), 2.2 Å

PDB Description: the structure of granulocyte-colony-stimulating factor and its relationship to those of other growth factors
PDB Compounds: (A:) granulocyte colony-stimulating factor

SCOP Domain Sequences for d1rhga_:

Sequence, based on SEQRES records: (download)

>d1rhga_ a.26.1.1 (A:) Granulocyte-colony stimulating factor (G-CSF) {Human (Homo sapiens) [TaxId: 9606]}
lpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplsscpsqa
lqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmeelgmap
alqptqgampafasafqrraggvlvashlqsflevsyrvlrhla

Sequence, based on observed residues (ATOM records): (download)

>d1rhga_ a.26.1.1 (A:) Granulocyte-colony stimulating factor (G-CSF) {Human (Homo sapiens) [TaxId: 9606]}
lpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwapllagclsq
lhsglflyqgllqalegispelgptldtlqldvadfattiwqqmeelgmmpafasafqrr
aggvlvashlqsflevsyrvlrhla

SCOP Domain Coordinates for d1rhga_:

Click to download the PDB-style file with coordinates for d1rhga_.
(The format of our PDB-style files is described here.)

Timeline for d1rhga_: