Lineage for d1rhga_ (1rhg A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46942Fold a.26: 4-helical cytokines [47265] (1 superfamily)
  4. 46943Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
  5. 46944Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)
  6. 46951Protein Granulocyte-colony stimulating factor (G-CSF) [47268] (3 species)
  7. 46958Species Human (Homo sapiens) [TaxId:9606] [47269] (4 PDB entries)
  8. 46959Domain d1rhga_: 1rhg A: [16812]

Details for d1rhga_

PDB Entry: 1rhg (more details), 2.2 Å

PDB Description: the structure of granulocyte-colony-stimulating factor and its relationship to those of other growth factors

SCOP Domain Sequences for d1rhga_:

Sequence, based on SEQRES records: (download)

>d1rhga_ a.26.1.1 (A:) Granulocyte-colony stimulating factor (G-CSF) {Human (Homo sapiens)}
lpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplsscpsqa
lqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmeelgmap
alqptqgampafasafqrraggvlvashlqsflevsyrvlrhla

Sequence, based on observed residues (ATOM records): (download)

>d1rhga_ a.26.1.1 (A:) Granulocyte-colony stimulating factor (G-CSF) {Human (Homo sapiens)}
lpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwapllagclsq
lhsglflyqgllqalegispelgptldtlqldvadfattiwqqmeelgmmpafasafqrr
aggvlvashlqsflevsyrvlrhla

SCOP Domain Coordinates for d1rhga_:

Click to download the PDB-style file with coordinates for d1rhga_.
(The format of our PDB-style files is described here.)

Timeline for d1rhga_: