Lineage for d2rgka_ (2rgk A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004180Family a.102.1.3: N-acylglucosamine (NAG) epimerase [48222] (2 protein domains)
    automatically mapped to Pfam PF07221
  6. 2004185Protein Putative NAG isomerase YihS [140788] (2 species)
  7. 2004186Species Escherichia coli [TaxId:562] [188589] (1 PDB entry)
  8. 2004187Domain d2rgka_: 2rgk A: [168118]
    automated match to d2afaa1
    complexed with epe

Details for d2rgka_

PDB Entry: 2rgk (more details), 2.5 Å

PDB Description: Functional annotation of Escherichia coli yihS-encoded protein
PDB Compounds: (A:) Uncharacterized sugar isomerase yihS

SCOPe Domain Sequences for d2rgka_:

Sequence, based on SEQRES records: (download)

>d2rgka_ a.102.1.3 (A:) Putative NAG isomerase YihS {Escherichia coli [TaxId: 562]}
mkwfntlshnrwleqetdrifdfgknsvvptgfgwlgnkgqikeemgthlwitarmlhvy
svaaamgrpgayslvdhgikamngalrdkkyggwyacvndegvvdaskqgyqhffallga
asavttghpearklldytieiiekyfwseeeqmcleswdeafskteeyrggnanmhavea
flivydvthdkkwldrairvasviihdvarnnhyrvnehfdtqwnplpdynkdnpahrfr
afggtpghwiewgrlmlhihaalearceqppawlledakglfnatvrdawapdgadgivy
tvdwegkpvvrervrwpiveamgtayalytvtgdrqyetwyqtwweycikylmdyengsw
wqeldadnkvttkvwdgkqdiyhllhclvipriplapgmapavaaglldinak

Sequence, based on observed residues (ATOM records): (download)

>d2rgka_ a.102.1.3 (A:) Putative NAG isomerase YihS {Escherichia coli [TaxId: 562]}
mkwfntlshnrwleqetdrifdfgknsvvptgfgwlgnkgqikeemgthlwitarmlhvy
svaaamgrpgayslvdhgikamngalrdkkyggwyacvndegvvdaskqgyqhffallga
asavttghpearklldytieiiekyfwseeeqmcleswdeafskteeyrggnanmhavea
flivydvthdkkwldrairvasviihdvarnnhyrvnehfdtqwnplpdynkdnpahrfr
afggtpghwiewgrlmlhihaalearceqppawlledakglfnatvrdawapdgadgivy
tvdwegkpvvrervrwpiveamgtayalytvtgdrqyetwyqtwweycikylmdyengsw
wqeldadnkvttgkqdiyhllhclvipriplapgmapavaaglldinak

SCOPe Domain Coordinates for d2rgka_:

Click to download the PDB-style file with coordinates for d2rgka_.
(The format of our PDB-style files is described here.)

Timeline for d2rgka_: