Lineage for d2rgaa_ (2rga A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 987810Protein cH-p21 Ras protein [52593] (1 species)
  7. 987811Species Human (Homo sapiens) [TaxId:9606] [52594] (84 PDB entries)
    Uniprot Q6P716
  8. 987847Domain d2rgaa_: 2rga A: [168112]
    automated match to d2rgda1
    complexed with ca, gnp, mg

Details for d2rgaa_

PDB Entry: 2rga (more details), 1.9 Å

PDB Description: Crystal structure of H-RasQ61I-GppNHp
PDB Compounds: (A:) gtpase hras

SCOPe Domain Sequences for d2rgaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rgaa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
ieeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

SCOPe Domain Coordinates for d2rgaa_:

Click to download the PDB-style file with coordinates for d2rgaa_.
(The format of our PDB-style files is described here.)

Timeline for d2rgaa_: