Lineage for d2rg2a_ (2rg2 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2996318Species Clostridium perfringens [TaxId:1502] [188628] (5 PDB entries)
  8. 2996323Domain d2rg2a_: 2rg2 A: [168111]
    automated match to d3pvaa_
    complexed with edo, gol, so4

Details for d2rg2a_

PDB Entry: 2rg2 (more details), 1.8 Å

PDB Description: crystal structure of variant r18l of conjugated bile acid hydrolase from clostridium perfringens
PDB Compounds: (A:) choloylglycine hydrolase

SCOPe Domain Sequences for d2rg2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rg2a_ d.153.1.0 (A:) automated matches {Clostridium perfringens [TaxId: 1502]}
ctglaletkdglhlfglnmdieysfnqsiifiprnfkcvnksnkkelttkyavlgmgtif
ddyptfadgmnekglgcaglnfpvyvsyskediegktnipvynfllwvlanfssveevke
alknanivdipisenipnttlhwmisditgksivveqtkeklnvfdnnigvltnsptfdw
hvanlnqyvglrynqvpefklgdqsltalgqgtglvglpgdftpasrfirvaflrdamik
ndkdsidlieffhilnnvamvrgstrtveeksdltqytscmclekgiyyyntyennqina
idmnkenldgneiktykynktlsinhvn

SCOPe Domain Coordinates for d2rg2a_:

Click to download the PDB-style file with coordinates for d2rg2a_.
(The format of our PDB-style files is described here.)

Timeline for d2rg2a_: