![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Fungus (Melanocarpus albomyces) [TaxId:204285] [188605] (4 PDB entries) |
![]() | Domain d2rg0a_: 2rg0 A: [168105] automated match to d1q9ha_ |
PDB Entry: 2rg0 (more details), 2.1 Å
SCOPe Domain Sequences for d2rg0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rg0a_ b.29.1.0 (A:) automated matches {Fungus (Melanocarpus albomyces) [TaxId: 204285]} eragnetpenhppltwqrctapgncqtvnaevvidanwrwlhddnmqncydgnqwtnacs tatdcaekcmiegagdylgtygastsgdaltlkfvtkheygtnvgsrfylmngpdkyqmf nlmgnelafdvdlstvecginsalyfvameedggmasypsnqagarygtgycdaqcardl kfvggkaniegwksstsdpnagvgpygsccaeidvwesnayafaftphacttneyhvcet tncggtysedrfagkcdangcdynpyrmgnpdfygkgktldtsrkftvvsrfeenklsqy fiqdgrkieippptwegmpnsseitpelcstmfdvfndrnrfeevggfeqlnnalrvpmv lvmsiwddhyanmlwldsiyppekegqpgaargdcptdsgvpaeveaqfpdaqvvwsnir fgpigstydf
Timeline for d2rg0a_: