Lineage for d2rfza_ (2rfz A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2044115Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2044116Protein automated matches [190437] (53 species)
    not a true protein
  7. 2044248Species Fungus (Melanocarpus albomyces) [TaxId:204285] [188605] (4 PDB entries)
  8. 2044257Domain d2rfza_: 2rfz A: [168101]
    automated match to d1q9ha_
    complexed with ctr

Details for d2rfza_

PDB Entry: 2rfz (more details), 1.8 Å

PDB Description: Crystal structure of cellobiohydrolase from Melanocarpus albomyces complexed with cellotriose
PDB Compounds: (A:) Cellulose 1,4-beta-cellobiosidase

SCOPe Domain Sequences for d2rfza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rfza_ b.29.1.0 (A:) automated matches {Fungus (Melanocarpus albomyces) [TaxId: 204285]}
eragnetpenhppltwqrctapgncqtvnaevvidanwrwlhddnmqncydgnqwtnacs
tatdcaekcmiegagdylgtygastsgdaltlkfvtkheygtnvgsrfylmngpdkyqmf
nlmgnelafdvdlstvecginsalyfvameedggmasypsnqagarygtgycdaqcardl
kfvggkaniegwksstsdpnagvgpygsccaeidvwesnayafaftphacttneyhvcet
tncggtysedrfagkcdangcdynpyrmgnpdfygkgktldtsrkftvvsrfeenklsqy
fiqdgrkieippptwegmpnsseitpelcstmfdvfndrnrfeevggfeqlnnalrvpmv
lvmsiwddhyanmlwldsiyppekegqpgaargdcptdsgvpaeveaqfpdaqvvwsnir
fgpigstydf

SCOPe Domain Coordinates for d2rfza_:

Click to download the PDB-style file with coordinates for d2rfza_.
(The format of our PDB-style files is described here.)

Timeline for d2rfza_: