Lineage for d2rfwb_ (2rfw B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2044115Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2044116Protein automated matches [190437] (53 species)
    not a true protein
  7. 2044248Species Fungus (Melanocarpus albomyces) [TaxId:204285] [188605] (4 PDB entries)
  8. 2044250Domain d2rfwb_: 2rfw B: [168094]
    automated match to d1q9ha_

Details for d2rfwb_

PDB Entry: 2rfw (more details), 1.6 Å

PDB Description: Crystal Structure of Cellobiohydrolase from Melanocarpus albomyces
PDB Compounds: (B:) Cellulose 1,4-beta-cellobiosidase

SCOPe Domain Sequences for d2rfwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rfwb_ b.29.1.0 (B:) automated matches {Fungus (Melanocarpus albomyces) [TaxId: 204285]}
eragnetpenhppltwqrctapgncqtvnaevvidanwrwlhddnmqncydgnqwtnacs
tatdcaekcmiegagdylgtygastsgdaltlkfvtkheygtnvgsrfylmngpdkyqmf
nlmgnelafdvdlstvecginsalyfvameedggmasypsnqagarygtgycdaqcardl
kfvggkaniegwksstsdpnagvgpygsccaeidvwesnayafaftphacttneyhvcet
tncggtysedrfagkcdangcdynpyrmgnpdfygkgktldtsrkftvvsrfeenklsqy
fiqdgrkieippptwegmpnsseitpelcstmfdvfndrnrfeevggfeqlnnalrvpmv
lvmsiwddhyanmlwldsiyppekegqpgaargdcptdsgvpaeveaqfpdaqvvwsnir
fgpigstydf

SCOPe Domain Coordinates for d2rfwb_:

Click to download the PDB-style file with coordinates for d2rfwb_.
(The format of our PDB-style files is described here.)

Timeline for d2rfwb_: